velove boutique since 2007 selling fashion for women and also for kids

We are the manufacture company of the T-Shirt. Since 1984. We can make any T-Shirt like what you want by your design or our design, you can chosse any cloth, any colour. We can make Promotion T-Shirt....

Batik' s Industry and Trading. Our products are all about clothes from batik. And our batik is originally traditional motif and process, but modern, dynamic, and luxurious in style, design and model.

We provide many kind of fashion for kids, many models of jilbabs, batik collection and many models of bedsheet. Get a good price.

We are producer of casual batik, which have modern ethnics desain. All our poduct 100 % handmade.

suplier feshion, mode and acsecories, place in purwokerto city, Indonesia country

We are one of the trading companies that provide apparel, like moslem wear, jeans for men and women, and shirt. Beside, we provide handicraft like women handbag from banana fibre, cloth from....

We are trading company specialized in Batik Clothes ( indonesian typical clothes) and Moslem clothes. We are now searching for long term partner to promote our product around the world. We are concern....

We sell exclusive batik clothing, wholesale and retail are accepted. please visit us on www.aksentropis.com

The shopping moeslem fashion in Yogyakarta, need suppliers moeslem fashion for adult, child, male, female, trendy and syar' i, tasbih, book/ CD/ VCD Islam, accessories etc.

MANUFACTURING HANDMADED LADIES HANDBAG. EXPORT TO COUNTRIES IN EUROPE AND AMERICA

CV. CARPILLUCI BANGKIT SEJAHTERA was extabilised of 9 June 2002 which have place industrial area sentra minimize konveksi/ garment in Purwoharjo Comal Kab. Pemalang Central Java. CV. CARPILLUCI....

offfonoffmnhgjgftfrtdtretrswtdvhjtredgvfghhjftrdytdtydwe4tddtydfdftyrtyfrffg hftefjdgfsdtydghcfdcghfhvfyfdrdmhtymvghklguishdiushifhshflsdjkfhlshuifhif

various Muslim wear, clothes & accessories, women clothes, muslim kids wear, bags, saree, silk, bedcover

Our business be actived in area production of art goods almost five years since 1996. Our market orientation during five years was in market domestic but more attention at tourist market segmentation....